PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596192.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ZF-HD
Protein Properties Length: 246aa    MW: 27996.6 Da    PI: 9.2779
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596192.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.92.8e-2963118258
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     ++vrY+eC++NhAas Ggh++D CgEfm+s geegta++l CaAC+CHR+FHR e +
  XP_013596192.1  63 RSVRYRECQRNHAASSGGHVIDVCGEFMSS-GEEGTAESLLCAACDCHRSFHRNEID 118
                     579**************************9.999*******************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-3151127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-2765117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.9E-2766117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.43367116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.8E-27175244IPR009057Homeodomain-like
SuperFamilySSF466894.31E-18175243IPR009057Homeodomain-like
PROSITE profilePS500719.118180244IPR001356Homeobox domain
TIGRFAMsTIGR015651.0E-26182238IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGDGKTKIIS KSSNPRSLYT SVHQSTTISN GSNLDLDLDT NPISFAAPAP RSYVRLKTTS  60
PTRSVRYREC QRNHAASSGG HVIDVCGEFM SSGEEGTAES LLCAACDCHR SFHRNEIDGM  120
FVVKFNSFGH SPRPLVSRHV SPIMMSFARG GRDPAESSTE DLNKFHQYFC GNGVDQSQYH  180
PKKRFRTKFN QEQKEKMEEF AEKIGWRMSK PEDSEVNLFC REINLKRQLF KVWMHNNMQT  240
AKKKEM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-181832371872ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596192.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-116ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D3D3240.0A0A0D3D324_BRAOL; Uncharacterized protein
STRINGBra037224.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-118homeobox protein 24